Wiktor Adamski

Joined on: 2021-02-25 recommendations: portfolio

My name is Wiktor, I love creating graphics and editing movies. He works in Adobe programs such as Photoshop, Premiere Pro, After effect or Ilustrator. I can also use Canva, Sony Vegas, Autodesk...

adobe illustratoradobe photoshopallegrobussines cardgraphicsillustrationslayout designleafletslogoonline shoppostersprestashoppromotional videosocial mediavideovideo editingwordpress

AnnaMaria2021

Joined on: 2021-02-23 recommendations: portfolio

For +20 years I have been dealing with copywriting in Polish and English. Specializations: - IT (MSc in Computer Science - several years of working for the largest global IT companies) - Creative...

articleblogcopywritingenglishsectorspecializedtechnicaltext editing

MartaCiesielska

Joined on: 2021-02-22 recommendations: portfolio

Hello! My name is Marta, I study American Studies on Jagiellonian University. I was prompted to start these studies by my interest in American English. Furthermore, I do run, work out and...

karo.zawiślak

Joined on: 2021-02-22 recommendations: portfolio

Hi! My name is Karolina and I would like to try to work as a freelancer. I graduated in engineering (chemical sciences) at the Wrocław University of Technology. I like analytical tasks - Excel and...

articleblogcanvadatabaseseditingexcelproduct descriptionspecializedvirtual office

Salus Rei

Joined on: 2021-02-21 recommendations: portfolio

I am a graduate of UK University medical school and a student of a Polish university, specialization - clinical nutrition. I have also a diploma in English and Spanish linguistics and work as...

adobe illustratoradobe indesignadobe photoshoparticleblogcopywritingeditingenglishgraphicsillustrationslayout designlayout designlogophotographyposterspre-pressrussianspanishtext editingtranslation

Alicja Ciemińska

Joined on: 2021-02-21 recommendations: portfolio

I will gladly write an industry text: 1) IT, AI, programming, data visualization, algorithmization, dataification, platformization, new technologies, digital sociology, digital revolution, machine...

articlecopywritingenglishgermansectorspecializedtext editing

Monika Włodarczyk

Joined on: 2021-02-20 recommendations: portfolio

I am offerring translation of short stories, novels, blog articles and subtitles done in a professional manner. I am currently studying English philology, with specialization in translation, on...

articleaudiovisual translationsblogeditingproduct descriptionspecializedtranslation

Aleksa_J

Joined on: 2021-02-20 recommendations: portfolio

Hello! My name is Ola. I'm a 4th year psychology student, and my biggest passion is writing (books, short stories, prose, novels). I'm an author of the book "Obudź mnie zanim umrę" (eng. "Wake me...

articleblogcopywritingenglishesaaygermanonline lessonspoetryprivate lessonsproduct descriptionsocial mediasurveystranscription of recordintranslation

Joanna Mucha

Joined on: 2021-02-19 recommendations: portfolio

I study English philology at Jagiellonian University, and I have a vast experience in writing, proofreading and editing a text. I offer translations.

articleblogcopywritingeditingenglishtext editingtranslation

Divloy

Joined on: 2021-02-18 recommendations: portfolio

Divloy is an digital marketing agency has over 10 years worth of experience. We have the ability to collect, measure and utilize data what separates us them apart from other, standard agencies. We...

adwordsauditcontent auditfacebookFacebook AdsFacebook Pixelgoogle adsGoogle AdWordsgoogle analyticsgoogle merchant centergoogle optimiziegoogle search consolegoogle shoppingGoogle Tag Manageronline advertisingoptimizationsearch optimizationseoseo auditsocial mediawoocommercewordpress

Magda Wiśniewska

Joined on: 2021-02-15 recommendations: deals opinions portfolio

I graduated with a master's degree in psychology from Jagiellonian University. Currently, I am a researcher in the domain of cognitive psychology, but I stay open to cooperation in the field of...

blogenglishfrenchtext editingtranslation

Jakub Grzebisz

Joined on: 2021-02-15 recommendations: portfolio

My name is Jakub. I am a young and creative student from Poland. Since I was little I had a very big interest in writing and creative job. When I was 9 I've created my first YouTube channel and...

Emil Ryż

Joined on: 2021-02-14 recommendations: deals portfolio

First of all I would like to welcome you personally to my profile. My name is Emil and I am a Social Media and Marketing Specialist with 5 years of experience. My specialization is social media...

articlebannerblogbuzzmarketingcopywritingeditingfanpagelayout designlogophotographyproduct descriptionsectorseoservice descriptionsocial mediaspecializedtext editingtranslationvector graphics

Anna Czarny

Joined on: 2021-02-14 recommendations: portfolio

I'm a first-year student of journalism and social communication at the University of Wrocław. I am interested in editing texts, writing articles, translating from English to Polish and from Polish...

articleenglishfacebookonline lessonsprivate lessonstext editingtranslation

martynas0797

Joined on: 2021-02-10 recommendations: portfolio

5th-year student on a Faculty of Veterinary Medicine, Wroclaw University of Environmental and Life Sciences English- level C1, bilingual Matura exam French- level A2, DELF certificate fluent...

articlebiotechnologycopywritingeditingenglishfanpagefrenchmedicineonline lessonspre-sell textservice descriptionsocial mediatext editingtranslation

Keyti

Joined on: 2021-02-09 recommendations: portfolio

I've always loved writing texts - stories. The world is changing, however demand for text always remains - now it's mostly digital. In my spare time, I still create short forms for Arkham Radio -...

copywritingeditingenglishfacebookfanpagepolishsocial mediatext editing

D.M.1108

Joined on: 2021-02-09 recommendations: portfolio

I am a freshman in collage, my major is Business and Administration (English-language major). I do not have much experience in offers given in UseMe. Even though, I am experienced in writing,...

articleblogcopywritingenglishfacebookfanpageonline lessonssocial mediatext editingtranslation

Zuza S.

Joined on: 2021-02-08 recommendations: portfolio

I am an open-minded person with an international approach to life and work. Creative mind seeking for new opportunities. Traveller, talker, observer, creator with an excellent eye for detail and...

copywritingenglishfacebookonline lessonssocial mediatext editingtranslation

Anna De Angelis

Joined on: 2021-02-07 recommendations: portfolio

I am a psychologist. I have seven years of work experience. In my professional work, apart from my duties as a psychologist, I co-created international projects, prepared the evaluation of the...

Daniel Bartosiewicz

Joined on: 2021-02-06 recommendations: portfolio

The content costs. On black hat forums, you can buy pseudo SEO-optimized articles for $5. You can. And you can order generate them randomly, they'll be worth nothing. It doesn't go like this with...

articleblogbuzzmarketingcontent marketingcopywritingeditingpre-sell textproduct descriptionsearch optimizationseoservice descriptiontext editingtranslation