Nefrite

Joined on: 2014-03-06

bookkeepingcmscopywritingdatabasesdomain namee-commerceenglishfrenchhtmllanguages onlinemysql.NETphppolishportalseosocial mediaspanishsqltranslationtypingvirtual officeweb site

jk

Joined on: 2014-03-04 recommendations: portfolio

bannerbusiness planbussines carddatabasesgraphicsleafletslogopolishpostersproposal writingtypingwindows

lherod.pl

Joined on: 2014-03-04 recommendations: portfolio

Chętnie nawiążę stałą współpracę, zapraszam na stronę portfolio: www.lherod.pl, www.dotpoint.pl, pozdrawiam Łukasz Herod Projektowanie Graficzne DOTPOINT

adobe photoshopanimationbannerbussines carddesigndigital paintingdrawingdtpeditingenglishgraphicsillustrationsinfographicslabelsleafletslogooverprintportalportraitpostersprintingretouchsketchweb designweb site

Green Dragon

Joined on: 2014-03-03 recommendations: portfolio

adobe photoshopadvertising textsanimationbannerbussines cardcopywritingcssdtpenglishfanpagegraphicshtmlleafletslogopostersretouchseotemplatesweb designweb site

Lex Ursulus

Joined on: 2014-03-03

consultingenglish

Barbara Wiśniewska

Joined on: 2014-03-03

advertisementarticleartistic translationcopywritingdatabaseseditinge-learningenglishfacebookfanpagegermanpolishpre-sell textproofreadingreviewsectorsemseotranslationtypingvirtual office

Artur

Joined on: 2014-03-02

adobe photoshopenglishhelpdeskserver

Mateusz Nieckarz

Joined on: 2014-02-28 recommendations: deals

adobe photoshopbussines carddtpenglishgraphicslogooverprintpolishprintingsketchweb designweb site

żuczkowski

Joined on: 2014-02-28 recommendations: portfolio

JESTEM

domain namee-commercegeneral applicationshtmlportalserverserver administrationserviceservice desktemplatesweb sitewindows server

poswojsku

Joined on: 2014-02-27 recommendations: portfolio

poswojsku sp z o.o. istnieje od 2010 roku. Zajmuje się kreacją i produkcją treści multimedialnych oraz zarządzaniem portalami informacyjnymi. Jest twórcą, właścicielem i zarządzającym m.in....

3dadvertisementanimationbannercmscsse-learningenglishgeneral applicationsgraphicshtmlillustrationsjavascriptmobile applicationsmotion graphicspolishportalpostersweb applicationweb designweb sitexmlxtml

paulina_bubacz

Joined on: 2014-02-27

articlecustomer servicee-marketingenglishhelpdeskportalproofreadingreportsalestelemarketingtypingvirtual office

Michał Dołęga

Joined on: 2014-02-27

3dactionscriptadobe photoshopadvertisementanimationbannerdesigndtpeditingenglishflashgraphicsillustrationsinfographicslabelsleafletslogomobile applicationsmotion graphicsoverprintpolishpostersprintingrussiantemplatesvideoweb design

Polvotech

Joined on: 2014-02-27

Adrian Pietrzak

Joined on: 2014-02-27 recommendations: deals opinions portfolio

Posiadam ponad 6 letnie doświadczenie w programowaniu. Zajmuję się tworzeniem aplikacji na urządzenia mobilne z systemem Android przy użyciu natywnych technologii (Android Studio, Kotlin, Java)....

androidc c#c++databasese-learningenglishjavamysqlpolishpresentationservervirtual office

DNL GRAFIKA

Joined on: 2014-02-26

3dadobe photoshopbussines cardenglishgraphicsgridillustrationsinfographicslogoportalpostersproduct descriptionsketch

Monika Kowalczyk

Joined on: 2014-02-26

englishgermanpolishspecializedtechnicaltranslationweb site

Srebrny

Joined on: 2014-02-25

advertisementadvertising textsarticlebusiness analysisconsultingcopywritingcustomer servicedata analysise-learninge-marketingenglishfacebookfanpagehelpdesklawyerlegal advicelegal analysispolishpresentationproofreadingreportreportreviewsocial mediatrainingtyping

Corner Art

Joined on: 2014-02-25 recommendations: portfolio

Corner Art | Specjalizujemy się w projektach graficznych, tworzeniu stron www oraz kompleksowych usługach związanych z drukiem. Zapraszamy do współpracy. | www.cornerart.pl

adobe photoshopbannerbussines cardcmscssdrawingenglishfacebookfanpagegraphicshtmlillustrationsinfographicsjavascriptlabelsleafletslogophppolishportalpostersprintingsocial mediatemplatesweb applicationweb designweb site

Mateusz Gumny

Joined on: 2014-02-24

adobe photoshoparticledatabasesenglishgermangraphicsleafletslogopolishretouchtyping

Anna Bogusz

Joined on: 2014-02-24 recommendations: portfolio

Biegle obsługuje komputer oraz programy z pakietu ms office. Posiadam bogate doświadczenie w sprzedaży marketingu i reklamie, pisze teksty popularnonaukowe (gł. kynologia).

databaseseditinge-marketingenglishfacebookfanpageleafletspolishpostersproofreadingreportreportsocial mediatyping